PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca6500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 402aa    MW: 44656.5 Da    PI: 4.9523
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca6500.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81.1e-53251521128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtd+elv++yLk+k+ gk++++ ++i+e+diyk+ePwdLp  +k+k++++ewyfF  +d+ky +g+r nrat +gyWkatg+d+++l+ + +
  Dca6500.1  25 LAPGFRFHPTDQELVSYYLKRKICGKPIRF-DAISETDIYKSEPWDLPglSKLKSRDNEWYFFGVQDRKYVNGSRVNRATGNGYWKATGNDRPILH-NLR 122
                579**************************9.99***************65599999****************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kktLvfy+grap g++t+Wvmheyrl
  Dca6500.1 123 TVGMKKTLVFYSGRAPCGKRTNWVMHEYRL 152
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-6216175IPR003441NAC domain
PROSITE profilePS5100557.85625175IPR003441NAC domain
PfamPF023653.8E-2727152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MAPPSTVVVA APPSSTAVAV TATSLAPGFR FHPTDQELVS YYLKRKICGK PIRFDAISET  60
DIYKSEPWDL PGLSKLKSRD NEWYFFGVQD RKYVNGSRVN RATGNGYWKA TGNDRPILHN  120
LRTVGMKKTL VFYSGRAPCG KRTNWVMHEY RLTDEDLAKS GVPMDAYLLC KILKKSGPGF  180
KPGEQYGPFV EEEWEKDESA LVPGEEGDDD MACNDDTRIE DSVQSINNSD PNPVTICGLS  240
MEVQEIPPLC KLERGDDGPV ACTVDPEPLS LGPNKRLRQS EPDSCLSNAS VISTMRTHGP  300
CSSSTGTTNF SCALLEFPLM EAGEPEERPS PPPANVIDIN VPPSYLKLFE DLRNEIYRTS  360
IEKESLKIEV MSARTMINIL QTKIDHLTKE NDDLKKSNLR DG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49191769169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694507.10.0PREDICTED: NAC domain-containing protein 2
TrEMBLA0A0J8BDY50.0A0A0J8BDY5_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000797911e-132(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.21e-102NAC domain containing protein 52